Gene phavu.G19833.gnm2.ann1.Phvul.008G189400.1


Sequence ID phavu.G19833.gnm2.ann1.Phvul.008G189400.1  add to my list
Species Phaseolus vulgaris
Alias No gene alias
Length 134aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 134 amino acids

>phavu.G19833.gnm2.ann1.Phvul.008G189400.1_PHAVU
MANMQIVPAYKNIVEAQYVEMMVPLYSYGCEKKIKKAFSNLKGIYSLNVDYYQQKVTVWG
ICNKNDVLETVRSKRKEARFWNQEDNVVLDKSQSPLSSPSLFSQKDFKPSLALTKVRSLS
LKAWKKVFTRSYSF




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP077751 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.008G189400.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
vitvi_pan_p022513 orthology 0.535 1 - -
vitvi_pan_p043739 orthology 0.379 1 171 2.62e-56