Gene phavu.G19833.gnm2.ann1.Phvul.009G247600.1
Sequence ID | phavu.G19833.gnm2.ann1.Phvul.009G247600.1 add to my list | ||
---|---|---|---|
Species | Phaseolus vulgaris | ||
Alias | No gene alias | ||
Length | 259aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 259 amino acids
>phavu.G19833.gnm2.ann1.Phvul.009G247600.1_PHAVU MDTKPSQLASQPFNYQTWFLKVSIHCEGCRRKVKKVLKSIDGVFTATIDPQQNKVTVTGN VALETLLKKLVRAGKQAEIWPENEGKISGKGLKKKKKKDEAREPQSVEKHKGTENASAKC NSENKSSSNNSPEKCSSGDQMPSKGGRSEGGGGAAKKKKNFFCQSGLSSVEAATGAPAHT GLQFQDFVGPVNVDPTRQHSLFYPESGVAAYNRLYPCYYFPSSPYTCAGLDQDGHHFQSA PLVSFEIFSDENVNGCSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.009G247600.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
cajca.ICPL87119.gnm1.ann1.C.cajan_16510.1 | orthology | 0.269 | 2 | 262.7 | 2.8e-70 |
soybn_pan_p016747 | orthology | 0.257 | 2 | 283 | 2.14e-96 |
soybn_pan_p026228 | orthology | 0.279 | 2 | - | - |
vitvi_pan_p015057 | orthology | 1 | 2 | 128 | 9.35e-36 |
vitvi_pan_p035873 | orthology | 1 | 2 | - | - |