Gene phavu.G19833.gnm2.ann1.Phvul.011G068700.1
| Sequence ID | phavu.G19833.gnm2.ann1.Phvul.011G068700.1 add to my list | ||
|---|---|---|---|
| Species | Phaseolus vulgaris | ||
| Alias | No gene alias | ||
| Length | 216aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 216 amino acids
>phavu.G19833.gnm2.ann1.Phvul.011G068700.1_PHAVU MKGVDLFCSSSASTAVTSTMHHRSTVRGRTKSYDHDGRKTQLCVPCSSQLPISPMPYLEK HRKSSADKDNRDTRRKSSGDVRDLYTHAAADGSSRRYLLGDAPFIEWVSDSNKFIPMLPS QHHVKDKPMPIKTNHPPTLRSSSSARSKDQVVVLRVSLHCKACEGKVRKHISKMEGVRSF SIEMETKKVTIIGDVTPLGVLASVSKVKSAQLWPCL
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for phavu.G19833.gnm2.ann1.Phvul.011G068700.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| FvH4_3g34750.1 | orthology | 0.756 | 4 | 158.3 | 5.4e-39 |
| Manes.04G029700.1 | orthology | 0.769 | 4 | - | - |
| Manes.11G135800.1 | orthology | 0.626 | 4 | 215.7 | 3.3e-56 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_21421.1 | orthology | 0.235 | 2 | 285.4 | 3.3e-77 |
| maldo_pan_p016590 | orthology | 0.791 | 4 | 190 | 1.28e-60 |
| maldo_pan_p031809 | orthology | 0.802 | 4 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.011G068500.1 | ultra-paralogy | 0.0339 | 0 | - | - |
| soybn_pan_p008062 | orthology | 0.19 | 1 | 335 | 4.58e-118 |
| soybn_pan_p029253 | orthology | 0.21 | 1 | - | - |