Gene phavu.G19833.gnm2.ann1.Phvul.L001641.1
| Sequence ID | phavu.G19833.gnm2.ann1.Phvul.L001641.1 add to my list |
|---|---|
| Species | Phaseolus vulgaris |
| Alias | No gene alias |
| Length | 129aa |
Length: 129 amino acids
>phavu.G19833.gnm2.ann1.Phvul.L001641.1_PHAVU MKRMDIFCASQASTAICLSMDQASCSSSSNTILLGGRVIDRHNPIIMTQEGALPNLSLPH VPPLTHPSTPSLTMSSTSPRKTLLPKLQQRVLKITGRRTHHRISLNMSPTLLNQLTALWV GVCLSQLLI
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Dr08089 | orthology | 1 | 1 | - | - |