Gene sorbi_pan_p014632
| Sequence ID | sorbi_pan_p014632 add to my list |
|---|---|
| Species | Sorghum bicolor |
| Alias | No gene alias |
| Pangenome status | Core (2/2) |
| Length | 97aa |
Length: 97 amino acids
>sorbi_pan_p014632_SORBI MQCKTWTDSHLIDRKQQRVSVCGAFVPRDVAIKLRNSTNRRVEILDIKEVVDAGAGGDRS GGQQPSGKKKKREGVADAVGQDDAATHVCLSTGRALM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
SORBI_Tx430_v1.0
SORBI_BTx623_v3.1.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Bv6_142170_makm.t1 | orthology | 1 | 1 | - | - |
| thecc_pan_p012357 | orthology | 1 | 2 | - | - |
| thecc_pan_p021026 | orthology | 1 | 2 | - | - |