Gene sorbi_pan_p028841
Sequence ID | sorbi_pan_p028841 add to my list |
---|---|
Species | Sorghum bicolor |
Alias | No gene alias |
Pangenome status | Dispensable (1/2) |
Length | 78aa |
Length: 78 amino acids
>sorbi_pan_p028841_SORBI MTAGYIVGSLVGSFAIAYLCDTFVSDKKAFGGSTPKTVSEKEWWQATDTKFQAWPRTAGP PVVMNPISRQNFIVKSTE
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for sorbi_pan_p028841
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Sspon.08G0017040-1P | orthology | 0.0742 | 1 | 162 | 4.23e-54 |
Sspon.08G0017040-2B | orthology | 0.0871 | 1 | - | - |
Sspon.08G0017140-1A | orthology | 0.0742 | 2 | - | - |
Sspon.08G0017140-2B | orthology | 0.0742 | 2 | - | - |