Gene soybn_pan_p008694
| Sequence ID | soybn_pan_p008694 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 126aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 126 amino acids
>soybn_pan_p008694_SOYBN MGKNKKVEQQNKVIIVEFKVSMYCNSCERTVAKVISKCKGVEKFITDMNEHRVVVTGRID PMKVFKKLKKKTGKKVEIVSNMDEEPNDESDKLVMMHQFAPENDSCIKTETIMMFSDENP NACVVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP343847 | Unannotated cluster |
| 4 | GP466810 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p008694
Represented sequence(s):
SOYBN_Wm82_a2_v1.0
SOYBN_ZH13
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G21490.1 | orthology | 1 | 10 | 101 | 7.83e-29 |
| Ca_27_985.2 | orthology | 1 | 11 | - | - |
| Ca_34_139.2 | orthology | 1 | 11 | - | - |
| Ca_43_446.2 | orthology | 1 | 10 | - | - |
| Cc03_g02440 | orthology | 1 | 10 | 89.4 | 2.63e-24 |
| Cg9g003840.1 | orthology | 0.7 | 5 | 128 | 3.43e-39 |
| Cm135610.1 | orthology | 0.732 | 5 | 120 | 3.08e-36 |
| Cs9g05250.1 | orthology | 0.615 | 4 | 139 | 9.21e-44 |
| DCAR_030575 | orthology | 1 | 9 | 99.4 | 6.98e-28 |
| FvH4_3g29750.1 | orthology | 0.806 | 6 | - | - |
| FvH4_4g16960.1 | orthology | 0.802 | 6 | 136 | 1.47e-42 |
| HanXRQChr08g0226491 | orthology | 1 | 9 | 100 | 4.56e-28 |
| MELO3C021374.2.1 | orthology | 0.928 | 7 | 117 | 3.84e-35 |
| Manes.15G018700.1 | orthology | 0.963 | 8 | 120 | 2.13e-36 |
| Solyc03g098650.2.1 | orthology | 1 | 9 | - | - |
| brana_pan_p026722 | orthology | 1 | 12 | 104 | 9.73e-30 |
| braol_pan_p034893 | orthology | 1 | 11 | 103 | 1.77e-29 |
| braol_pan_p054032 | orthology | 1 | 10 | - | - |
| brarr_pan_p010495 | orthology | 1 | 12 | 104 | 7.85e-30 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04222.1 | orthology | 0.218 | 2 | 196 | 2.48e-66 |
| cicar_pan_p022803 | orthology | 0.299 | 4 | 152 | 3.82e-49 |
| cucsa_pan_p017292 | orthology | 0.962 | 7 | 115 | 2.85e-34 |
| medtr_pan_p033077 | orthology | 0.337 | 4 | 174 | 1.04e-57 |
| phavu.G19833.gnm2.ann1.Phvul.003G099700.1 | orthology | 0.261 | 1 | 187 | 5.9e-63 |
| soybn_pan_p032351 | ultra-paralogy | 0.125 | 0 | - | - |
| thecc_pan_p001371 | orthology | 0.763 | 7 | - | - |
| vitvi_pan_p022438 | orthology | 1 | 7 | 104 | 6.18e-30 |
| vitvi_pan_p032656 | orthology | 1 | 7 | - | - |