Gene soybn_pan_p009673
| Sequence ID | soybn_pan_p009673 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 259aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 259 amino acids
>soybn_pan_p009673_SOYBN MGEEEEKKEETTEEKKEKEPPEIVLKVDMHCEACARKVAKALKGFEGVEEVTADSKASKV VVKGKAADPIKVCERLQKKSGKKVELISPLPKPPEEKKEEEIKEEPQPEEKKEELPPVVT VVLKVRMHCEACAQVIQKRIRKIQGVESVETSLGNDQVIVKGVIDPAKLVDYVYKRTKKQ ASIVKEEEKEKKEEEEKKEEEKKEEKEEEKKGEDGEEVDTKTDIKRSEYWPLRSHVDYVD YPYASQIFSDENPNACTVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p009673
Represented sequence(s):
SOYBN_Wm82_a2_v1.0
SOYBN_ZH13
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.528 | 6 | - | - |
| Ca_32_762.1 | orthology | 0.592 | 6 | - | - |
| Ca_69_1.19 | orthology | 0.592 | 6 | - | - |
| Ca_78_26.1 | orthology | 0.528 | 6 | - | - |
| Ca_9_645.2 | orthology | 0.588 | 5 | - | - |
| Cc09_g00430 | orthology | 0.587 | 6 | - | - |
| Cg2g046420.1 | orthology | 0.427 | 6 | - | - |
| Cm145580.1 | orthology | 0.643 | 5 | - | - |
| Cm298860.1 | orthology | 0.432 | 5 | - | - |
| Cs2g01750.1 | orthology | 0.427 | 6 | - | - |
| DCAR_002239 | orthology | 0.484 | 6 | - | - |
| DCAR_030843 | orthology | 0.526 | 6 | - | - |
| FvH4_3g00420.1 | orthology | 0.391 | 6 | 269 | 5.88e-91 |
| HanXRQChr16g0515801 | orthology | 0.627 | 6 | - | - |
| MELO3C008010.2.1 | orthology | 0.534 | 5 | - | - |
| Manes.09G082500.1 | orthology | 0.58 | 5 | - | - |
| Manes.S022000.1 | orthology | 0.354 | 5 | - | - |
| Oeu029318.1 | orthology | 0.409 | 5 | - | - |
| Oeu057024.1 | orthology | 0.447 | 5 | - | - |
| PGSC0003DMP400023518 | orthology | 0.741 | 8 | - | - |
| PGSC0003DMP400026383 | orthology | 0.505 | 7 | - | - |
| Solyc04g015030.2.1 | orthology | 0.513 | 7 | - | - |
| Solyc11g012690.1.1 | orthology | 0.79 | 8 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.135 | 2 | - | - |
| capan_pan_p012494 | orthology | 0.643 | 6 | - | - |
| capan_pan_p018045 | orthology | 0.756 | 7 | - | - |
| cucsa_pan_p011686 | orthology | 0.522 | 5 | - | - |
| ipotf_pan_p000797 | orthology | 0.527 | 7 | - | - |
| itb01g10210.t2 | orthology | 0.534 | 7 | - | - |
| maldo_pan_p012376 | orthology | 0.403 | 6 | - | - |
| maldo_pan_p020510 | orthology | 0.413 | 6 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.122 | 2 | 289 | 9.84e-99 |
| soybn_pan_p024238 | ultra-paralogy | 0.0428 | 0 | - | - |
| thecc_pan_p018912 | orthology | 0.322 | 5 | - | - |
| vitvi_pan_p012828 | orthology | 0.382 | 4 | - | - |