Gene soybn_pan_p011905
| Sequence ID | soybn_pan_p011905 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 132aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 132 amino acids
>soybn_pan_p011905_SOYBN MGKLSWMLDKFCISSCSNTCFCVNSMEFEDEFESKPLIASDSDHKLRLKDVVNGKQTLAF QLKPKIVILRVSMHCHGCAKRVEKHISKLEGVSSYKVDLETKMVVVCGDILPSEVLESVS KVKNAELWNSPC
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p011905
Represented sequence(s):
SOYBN_ZH13
SOYBN_Wm82_a2_v1.0
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. Glyma05g35295.3 | 0.00 | 6.26 | -0.00 | 6.26 |
| 2. Glyma08g04430.1 | 6.26 | 0.00 | 6.26 | -0.00 |
| 3. SoyZH13_05G217800.m1 | -0.00 | 6.26 | 0.00 | 6.26 |
| 4. SoyZH13_08G038000.m1 | 6.26 | -0.00 | 6.26 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| MELO3C025323.2.1 | orthology | 0.519 | 4 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_15643.1 | orthology | 0.119 | 2 | 237 | 2.83e-82 |
| cucsa_pan_p016074 | orthology | 0.503 | 4 | 172 | 1.3e-56 |
| phavu.G19833.gnm2.ann1.Phvul.002G314600.1 | orthology | 0.124 | 1 | 238 | 8.91e-83 |