Gene soybn_pan_p018217
| Sequence ID | soybn_pan_p018217 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 140aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 140 amino acids
>soybn_pan_p018217_SOYBN MTIVEMCVHMDCPGCETKIKKALKKLRGVDDVDIDMRMQKVTVMGWADQKKVLKTVRKTG RRAELWPYPYNPEYHALARHYGNGNYFASAKPSSSYNYYKHGYSYGEDFGYYHKPIGAAI IDEKAMSMFSDDNPHACSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p018217
Represented sequence(s):
SOYBN_ZH13
SOYBN_Wm82_a2_v1.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg7g011400.1 | orthology | 0.47 | 4 | 191 | 5.65e-63 |
| Cm129650.1 | orthology | 0.494 | 4 | 177 | 6.18e-58 |
| FvH4_3g07830.1 | orthology | 0.683 | 5 | 154 | 4.37e-49 |
| Manes.17G055500.1 | orthology | 0.438 | 3 | 190 | 2.77e-63 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_31664.1 | orthology | 0.0972 | 2 | 250 | 2.47e-87 |
| cicar_pan_p021456 | orthology | 0.215 | 2 | 213 | 4.95e-73 |
| maldo_pan_p003465 | orthology | 0.743 | 5 | - | - |
| maldo_pan_p053909 | orthology | 0.704 | 5 | 167 | 9.85e-54 |
| thecc_pan_p000996 | orthology | 0.594 | 4 | 178 | 6.98e-59 |