Gene soybn_pan_p025142
| Sequence ID | soybn_pan_p025142 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 277aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 277 amino acids
>soybn_pan_p025142_SOYBN MKRIDIFCASQASTAICLSMDQASCSSSNTILLGGRTIDRHNPIINDSRRSTSKSLTAPC SSSQSPINPKPYHELHKAKKNSSSKNATKGHDNQKKRSTAEKLTEHVTNTSKPIDDIVPR SWLKPPADLITPPGSTRSLLSDTALLDGSSDYDPVLALTTMINNKTSQAVHQDEANPVSK LSSSSHPKSGSSDQQVVVLRVSLHCKGCEGKVRKHLSRMQGVTSFNIDFASKKVTVVGDV TPLSVLASISKVKNAQLWPASASAVESGTVETEKKYI
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p025142
Represented sequence(s):
SOYBN_ZH13
SOYBN_Wm82_a2_v1.0
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. Glyma10g05250.2 | 0.00 | 9.09 | 0.36 | 9.12 |
| 2. Glyma13g19630.2 | 9.09 | 0.00 | 9.12 | -0.00 |
| 3. SoyZH13_10G044300.m1 | 0.36 | 9.12 | 0.00 | 9.12 |
| 4. SoyZH13_13G115000.m1 | 9.12 | -0.00 | 9.12 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G37390.1 | orthology | 0.991 | 4 | 164 | 8.05e-50 |
| AT3G53530.2 | orthology | 0.95 | 4 | - | - |
| MELO3C003095.2.1 | orthology | 0.83 | 4 | 199 | 2.63e-63 |
| brana_pan_p029929 | orthology | 1 | 6 | - | - |
| brana_pan_p030312 | orthology | 0.992 | 6 | 163 | 8.02e-49 |
| brana_pan_p031480 | orthology | 1 | 5 | - | - |
| brana_pan_p036701 | orthology | 1 | 6 | - | - |
| brana_pan_p041953 | orthology | 1 | 5 | - | - |
| braol_pan_p003859 | orthology | 1 | 5 | - | - |
| braol_pan_p015324 | orthology | 1 | 5 | - | - |
| braol_pan_p021666 | orthology | 1 | 5 | - | - |
| braol_pan_p031578 | orthology | 0.991 | 5 | 173 | 1.02e-52 |
| brarr_pan_p002630 | orthology | 1 | 6 | - | - |
| brarr_pan_p008392 | orthology | 1 | 6 | 169 | 2.49e-51 |
| brarr_pan_p026146 | orthology | 1 | 6 | - | - |
| brarr_pan_p039884 | orthology | 1 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_37472.1 | orthology | 0.0982 | 2 | 434 | 2.12e-155 |
| cucsa_pan_p020833 | orthology | 0.85 | 4 | 189 | 3.17e-59 |
| phavu.G19833.gnm2.ann1.Phvul.L001741.1 | orthology | 0.168 | 2 | 378 | 1.47e-133 |