Gene soybn_pan_p030070
| Sequence ID | soybn_pan_p030070 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 119aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 119 amino acids
>soybn_pan_p030070_SOYBN KLKKALFKLKGVDEVEVEMEAQKITVKGYGLEEKKVLKAIKRAGKAAEPWPFPGHAHFSS FYKYPSYIVNHYYDAYKSEATNGVHTFFHTPAVYSVAVASDEAFASLFSDDNPHACTIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p030070
Represented sequence(s):
SOYBN_Wm82_a2_v1.0
SOYBN_ZH13
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. Glyma16g31260.1 | 0.00 | 0.84 | 0.73 | 0.74 |
| 2. Glyma09g25510.2 | 0.84 | 0.00 | 1.70 | -0.00 |
| 3. SoyZH13_16G166300.m1 | 0.73 | 1.70 | 0.00 | 1.49 |
| 4. SoyZH13_09G124900.m1 | 0.74 | -0.00 | 1.49 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G48970.1 | orthology | 0.295 | 4 | 177 | 5.63e-59 |
| AUR62015981-RA | orthology | 0.41 | 7 | 189 | 6.33e-62 |
| Bv3_055490_mxet.t1 | orthology | 0.443 | 7 | 188 | 2.34e-63 |
| Ca_8_1007.1 | orthology | 0.337 | 10 | 183 | 7.7e-61 |
| Cc02_g02970 | orthology | 0.337 | 10 | 183 | 2.44e-61 |
| Cg9g026790.1 | orthology | 0.163 | 6 | 206 | 2.6e-70 |
| Cm028340.1 | orthology | 0.163 | 6 | 206 | 4.38e-70 |
| Cs9g17280.1 | orthology | 0.163 | 6 | 206 | 2.83e-70 |
| DCAR_009368 | orthology | 0.416 | 12 | 181 | 1.86e-60 |
| FvH4_7g29520.1 | orthology | 0.203 | 7 | 198 | 4.45e-67 |
| HanXRQChr06g0183831 | orthology | 0.419 | 7 | - | - |
| HanXRQChr09g0253621 | orthology | 0.446 | 7 | 177 | 1.29e-58 |
| MELO3C003319.2.1 | orthology | 0.393 | 7 | 157 | 1.38e-50 |
| Manes.14G025900.1 | orthology | 0.236 | 7 | 205 | 8.65e-70 |
| Mba01_g04690.1 | orthology | 0.665 | 12 | 147 | 4.58e-47 |
| Oeu024220.1 | orthology | 0.312 | 9 | 190 | 7.29e-64 |
| PGSC0003DMP400025270 | orthology | 0.33 | 12 | 186 | 3.84e-62 |
| Solyc03g025790.2.1 | orthology | 0.32 | 12 | 186 | 3.82e-62 |
| brana_pan_p044950 | orthology | 0.268 | 5 | 186 | 6.55e-62 |
| braol_pan_p025375 | orthology | 0.268 | 6 | 186 | 6.34e-62 |
| brarr_pan_p005835 | orthology | 0.268 | 6 | 186 | 5.64e-62 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.0481 | 2 | 229 | 2.05e-79 |
| capan_pan_p012989 | orthology | 0.343 | 11 | 188 | 3.51e-63 |
| cucsa_pan_p007884 | orthology | 0.36 | 7 | 165 | 9.62e-54 |
| evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.629 | 10 | 160 | 1.94e-52 |
| ipotf_pan_p019855 | orthology | 0.342 | 11 | 176 | 3.64e-58 |
| ipotf_pan_p021461 | orthology | 0.514 | 11 | - | - |
| itb03g13280.t1 | orthology | 0.342 | 11 | 176 | 3.94e-58 |
| itb12g25750.t1 | orthology | 0.501 | 11 | - | - |
| maldo_pan_p005834 | orthology | 0.209 | 7 | 204 | 2.64e-69 |
| maldo_pan_p046866 | orthology | 0.634 | 7 | - | - |
| medtr_pan_p031372 | orthology | 0.0573 | 2 | 221 | 4.32e-76 |
| musac_pan_p029616 | orthology | 0.652 | 12 | 147 | 7.19e-47 |
| phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.046 | 2 | 230 | 7.4e-80 |
| thecc_pan_p002573 | orthology | 0.183 | 7 | 213 | 7.09e-73 |
| vitvi_pan_p028565 | orthology | 0.255 | 6 | 186 | 1.81e-62 |