Gene soybn_pan_p032804
Sequence ID | soybn_pan_p032804 add to my list | ||
---|---|---|---|
Species | Glycine max | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 142aa | ||
Gene Ontology |
![]()
|
Length: 142 amino acids
>soybn_pan_p032804_SOYBN MTIIEMRVHMDCPGCENKVKSALQKLKGVDDIEIDMSLQKVTVNGYADQKKVLKTVRKTG RRAELWQLPYTTDSQNQYVQQHHCNGPINYYASQTSSSYNYYKHGYDSSDPRYYNYPSQS SIFGYQTGATFSDDNPHACAIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p032804
Represented sequence(s):
SOYBN_ZH13
SOYBN_Wm82_a2_v1.0
1. | 2. | 3. | 4. | |
---|---|---|---|---|
1. Glyma12g33810.1 | 0.00 | 3.59 | -0.00 | 3.72 |
2. Glyma13g36680.2 | 3.59 | 0.00 | 3.59 | -0.00 |
3. SoyZH13_12G189200.m1 | -0.00 | 3.59 | 0.00 | 3.72 |
4. SoyZH13_13G265800.m1 | 3.72 | -0.00 | 3.72 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT1G06330.1 | orthology | 0.577 | 8 | 184 | 3.52e-61 |
Cg2g008690.1 | orthology | 0.483 | 7 | 213 | 1.75e-72 |
Cm103060.1 | orthology | 0.477 | 8 | 213 | 2.07e-72 |
Cs2g15540.1 | orthology | 0.477 | 8 | 216 | 1.46e-73 |
FvH4_6g27360.1 | orthology | 0.56 | 7 | 190 | 2.6e-63 |
MELO3C018725.2.1 | orthology | 0.637 | 8 | 184 | 3.81e-61 |
Manes.15G048400.1 | orthology | 0.312 | 4 | 224 | 7.31e-77 |
brana_pan_p013116 | orthology | 0.553 | 9 | 182 | 6.83e-60 |
braol_pan_p024201 | orthology | 0.553 | 9 | 182 | 6.2e-60 |
brarr_pan_p028890 | orthology | 0.553 | 9 | 182 | 5.52e-60 |
cajca.ICPL87119.gnm1.ann1.C.cajan_23872.1 | orthology | 0.0659 | 1 | 268 | 2.23e-94 |
cucsa_pan_p019751 | orthology | 0.629 | 8 | 181 | 8.39e-60 |
medtr_pan_p000903 | orthology | 0.166 | 3 | 251 | 1.07e-87 |
phavu.G19833.gnm2.ann1.Phvul.005G095400.1 | orthology | 0.0817 | 2 | 274 | 1.27e-96 |
thecc_pan_p014674 | orthology | 0.358 | 7 | 170 | 1.79e-55 |
vitvi_pan_p026446 | orthology | 0.496 | 7 | 206 | 1.52e-69 |