Gene soybn_pan_p036417


Sequence ID soybn_pan_p036417  add to my list
Species Glycine max
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 109aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 109 amino acids

>soybn_pan_p036417_SOYBN
MDALDYLSNFCTVTSTRTKQKAMQTTEIKVRMDCDGCERRVRNAVSSIKGVKSVEVNRKE
SRVVVRGYVDPKKVLKRVRSTGKVRAQFWPYVNNIWSSVLFFDLCSSLN




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for soybn_pan_p036417



Represented sequence(s):
SOYBN_Wm82_a2_v1.0
Glyma14g28740.2
Unrepresented genome(s):
SOYBN_ZH13


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
MELO3C020306.2.1 orthology 0.596 5 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_32061.1 orthology 0.314 1 - -
cucsa_pan_p006945 orthology 0.602 5 - -
medtr_pan_p021579 orthology 0.483 3 - -
phavu.G19833.gnm2.ann1.Phvul.004G001200.1 orthology 0.346 2 - -
soybn_pan_p022431 ultra-paralogy 0.183 0 - -
soybn_pan_p025671 ultra-paralogy 0.201 0 - -
soybn_pan_p036295 ultra-paralogy 0.152 0 - -
soybn_pan_p037957 ultra-paralogy 0.58 0 - -
soybn_pan_p038110 ultra-paralogy 0.158 0 - -
soybn_pan_p043279 ultra-paralogy 0.197 0 - -