Gene soybn_pan_p041984
| Sequence ID | soybn_pan_p041984 add to my list | ||
|---|---|---|---|
| Species | Glycine max | ||
| Alias | No gene alias | ||
| Pangenome status | Dispensable (1/2) | ||
| Length | 94aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 94 amino acids
>soybn_pan_p041984_SOYBN MEIVELKVEMVGIHEKRLRKCLAKLKGWFGIEKVEVDCNSQKVVVTGYAHKNKILKALRK AGLKAHFWSSKNDLLNAYLSASYANLKFNNFSIF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p041984
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_12_32.9 | orthology | 0.554 | 7 | - | - |
| Ca_3_262.11 | orthology | 0.554 | 7 | - | - |
| Ca_455_136.3 | orthology | 0.554 | 7 | - | - |
| Ca_68_16.11 | orthology | 0.578 | 7 | - | - |
| Cc10_g00290 | orthology | 0.578 | 7 | - | - |
| Cg3g025710.1 | orthology | 0.414 | 7 | - | - |
| Cm122260.1 | orthology | 0.426 | 6 | - | - |
| Cs3g27690.1 | orthology | 0.414 | 7 | - | - |
| DCAR_023025 | orthology | 0.438 | 4 | - | - |
| HORVU7Hr1G051110.3 | orthology | 1 | 9 | 77.4 | 3.15e-20 |
| MELO3C017056.2.1 | orthology | 0.56 | 7 | - | - |
| Manes.05G127500.1 | orthology | 0.453 | 5 | - | - |
| Manes.18G002200.1 | orthology | 0.466 | 5 | - | - |
| Mba08_g25790.1 | orthology | 0.785 | 7 | - | - |
| ORGLA08G0178600.1 | orthology | 0.882 | 8 | - | - |
| Oeu013567.1 | orthology | 0.458 | 5 | - | - |
| Sspon.06G0001840-1A | orthology | 1 | 7 | - | - |
| Sspon.06G0001840-2C | orthology | 0.902 | 7 | - | - |
| Sspon.06G0001840-3D | orthology | 0.912 | 7 | - | - |
| XP_010932092.1 | orthology | 0.591 | 6 | - | - |
| XP_017697769.1 | orthology | 0.616 | 6 | - | - |
| XP_019707878.1 | orthology | 0.629 | 7 | - | - |
| bradi_pan_p007471 | orthology | 0.893 | 8 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 | orthology | 0.249 | 1 | - | - |
| capan_pan_p037558 | orthology | 0.565 | 6 | - | - |
| cocnu_pan_p024788 | orthology | 0.591 | 6 | - | - |
| cocnu_pan_p029661 | orthology | 0.655 | 7 | - | - |
| cucsa_pan_p017207 | orthology | 0.56 | 7 | - | - |
| maize_pan_p023740 | orthology | 0.884 | 7 | - | - |
| maldo_pan_p020708 | orthology | 0.45 | 5 | - | - |
| musac_pan_p036492 | orthology | 0.773 | 7 | - | - |
| orysa_pan_p046260 | orthology | 0.858 | 8 | - | - |
| sorbi_pan_p020199 | orthology | 0.86 | 7 | - | - |
| soybn_pan_p037728 | ultra-paralogy | 0.216 | 0 | - | - |
| soybn_pan_p037999 | ultra-paralogy | 0.0324 | 0 | - | - |
| thecc_pan_p004256 | orthology | 0.462 | 6 | - | - |
| tritu_pan_p008810 | orthology | 0.898 | 9 | - | - |
| vitvi_pan_p014910 | orthology | 0.376 | 4 | - | - |
| vitvi_pan_p031077 | orthology | 0.376 | 4 | - | - |