Gene soybn_pan_p043041
Sequence ID | soybn_pan_p043041 add to my list | ||
---|---|---|---|
Species | Glycine max | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 115aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 115 amino acids
>soybn_pan_p043041_SOYBN MEKKDKGNKEEAKDKKKKEEPPPEIVLKVDMHCEACARKVAKALKGFQGVEEVSADSRTN KVVVKGKTTDPIKVCERLQKKSGKKLELISPLPKPQRRKKNHPKKNHQKWRKKYE
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p043041
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
vitvi_pan_p036932 | orthology | 0.329 | 1 | - | - |