Gene soybn_pan_p043279
Sequence ID | soybn_pan_p043279 add to my list | ||
---|---|---|---|
Species | Glycine max | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 97aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 97 amino acids
>soybn_pan_p043279_SOYBN MGALDYLSNFCTVTSTRTKQKAMQTTEIKVRMDCDGCERRVRNAVSSIKGVKSVEVNRKE SRVVVRGYVDPKKVLKRKLRLIILEPDNEQQSLYLRI
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p043279
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
MELO3C020306.2.1 | orthology | 0.711 | 5 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_32061.1 | orthology | 0.429 | 1 | - | - |
cucsa_pan_p006945 | orthology | 0.716 | 5 | - | - |
medtr_pan_p021579 | orthology | 0.598 | 3 | - | - |
phavu.G19833.gnm2.ann1.Phvul.004G001200.1 | orthology | 0.461 | 2 | - | - |
soybn_pan_p022431 | ultra-paralogy | 0.298 | 0 | - | - |
soybn_pan_p025671 | ultra-paralogy | 0.316 | 0 | - | - |
soybn_pan_p036295 | ultra-paralogy | 0.133 | 0 | - | - |
soybn_pan_p036417 | ultra-paralogy | 0.197 | 0 | - | - |
soybn_pan_p037957 | ultra-paralogy | 0.695 | 0 | - | - |
soybn_pan_p038110 | ultra-paralogy | 0.273 | 0 | - | - |