Gene soybn_pan_p043513
| Sequence ID | soybn_pan_p043513 add to my list |
|---|---|
| Species | Glycine max |
| Alias | No gene alias |
| Pangenome status | Dispensable (1/2) |
| Length | 50aa |
Length: 50 amino acids
>soybn_pan_p043513_SOYBN MAKATTNDNNSLLHLENLTLPSFQVVVIAANMGCNGCRGRVSRVVSKMTG
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP022701 | Unannotated cluster |
| 3 | GP047979 | Unannotated cluster |
| 4 | GP468909 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G35730.1 | orthology | 1 | 5 | - | - |
| Cm212920.1 | orthology | 1 | 5 | - | - |
| Manes.02G038800.1 | orthology | 1 | 5 | - | - |
| brana_pan_p001635 | orthology | 1 | 6 | - | - |
| brana_pan_p054319 | orthology | 1 | 6 | - | - |
| braol_pan_p040844 | orthology | 1 | 6 | - | - |
| braol_pan_p052965 | orthology | 1 | 6 | - | - |
| brarr_pan_p008654 | orthology | 1 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_01523.1 | orthology | 0.173 | 2 | - | - |
| cicar_pan_p024775 | orthology | 0.29 | 3 | - | - |
| cucsa_pan_p023048 | orthology | 1 | 5 | - | - |
| maize_pan_p044279 | orthology | 0.722 | 4 | - | - |
| medtr_pan_p004416 | orthology | 0.391 | 3 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.003G219900.1 | orthology | 0.189 | 2 | - | - |
| soybn_pan_p039239 | ultra-paralogy | 0.001 | 0 | - | - |
| soybn_pan_p045249 | ultra-paralogy | 0.0673 | 0 | - | - |