Gene soybn_pan_p045249
Sequence ID | soybn_pan_p045249 add to my list | ||
---|---|---|---|
Species | Glycine max | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 113aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 113 amino acids
>soybn_pan_p045249_SOYBN MAINKTEICMKATTSNKRSLLHLENLTLPSFQVVVIAANMGCNGCRGRVSRVVSKITGLT EYTVDVRKKEVTIKGDFIANCNFQNETIRRNTLQSANDPPKSLSTFLTHSDEH
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP022701 | Unannotated cluster |
3 | GP047979 | Unannotated cluster |
4 | GP468909 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for soybn_pan_p045249
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT2G35730.1 | orthology | 1 | 5 | 74.3 | 1.49e-18 |
Cm212920.1 | orthology | 1 | 5 | 90.9 | 6.85e-25 |
Manes.02G038800.1 | orthology | 1 | 5 | - | - |
brana_pan_p001635 | orthology | 1 | 6 | 73.2 | 7.66e-18 |
brana_pan_p054319 | orthology | 1 | 6 | - | - |
braol_pan_p040844 | orthology | 1 | 6 | 73.2 | 6.95e-18 |
braol_pan_p052965 | orthology | 1 | 6 | - | - |
brarr_pan_p008654 | orthology | 1 | 5 | 75.1 | 1.8e-18 |
cajca.ICPL87119.gnm1.ann1.C.cajan_01523.1 | orthology | 0.203 | 2 | 164 | 3.93e-54 |
cicar_pan_p024775 | orthology | 0.32 | 3 | - | - |
cucsa_pan_p023048 | orthology | 1 | 5 | 80.1 | 4.01e-21 |
maize_pan_p044279 | orthology | 0.751 | 4 | - | - |
medtr_pan_p004416 | orthology | 0.421 | 3 | - | - |
phavu.G19833.gnm2.ann1.Phvul.003G219900.1 | orthology | 0.218 | 2 | 171 | 1.14e-56 |
soybn_pan_p039239 | ultra-paralogy | 0.0673 | 0 | - | - |
soybn_pan_p043513 | ultra-paralogy | 0.0673 | 0 | - | - |