Gene thecc_pan_p001600
| Sequence ID | thecc_pan_p001600 add to my list | ||
|---|---|---|---|
| Species | Theobroma cacao | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 172aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 172 amino acids
>thecc_pan_p001600_THECC MASWVKKLSRPRVTNCRFRLRFSSPASISCPPKPLEVVLAANLGCTRCQKRVADAISRID GEGRDRFCCMVMKINIDCNGCYRKVRRALLDIQELDTHLIEKKQCRVSVCGRFIPQDIAI KIRKKTNRRVEILEIQEFNIDNEQISHEEKALISSWNPESNQNHVATCVTCT
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for thecc_pan_p001600
Represented sequence(s):
THECC_Criollo_v2.0
THECC_Matina1_6_v1.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Bv5_110870_wcqq.t1 | orthology | 0.729 | 2 | 110 | 5.45e-32 |
| Bv5_110870_wcqq.t2 | orthology | 0.729 | 2 | - | - |
| CgUng002450.1 | orthology | 0.769 | 7 | 145 | 1.22e-45 |
| Cm118330.1 | orthology | 0.768 | 6 | 143 | 1.17e-44 |
| Cs7g26570.1 | orthology | 0.769 | 7 | 145 | 1.32e-45 |
| FvH4_5g12320.1 | orthology | 0.92 | 6 | 144 | 2.81e-44 |
| Manes.05G138100.1 | orthology | 0.612 | 5 | 117 | 5.66e-34 |
| PGSC0003DMP400010112 | orthology | 1 | 7 | 119 | 9.88e-35 |
| Solyc03g119630.2.1 | orthology | 1 | 8 | 120 | 6.98e-36 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1 | orthology | 0.88 | 6 | 131 | 2.41e-40 |
| capan_pan_p000343 | orthology | 1 | 8 | - | - |
| cicar_pan_p024669 | orthology | 1 | 7 | 120 | 1.12e-35 |
| cucsa_pan_p010693 | orthology | 0.585 | 2 | 142 | 2.88e-44 |
| maldo_pan_p026714 | orthology | 0.904 | 6 | - | - |
| medtr_pan_p036900 | orthology | 1 | 7 | 121 | 7.2e-36 |
| phavu.G19833.gnm2.ann1.Phvul.004G158700.1 | orthology | 0.948 | 6 | 129 | 2.02e-39 |
| soybn_pan_p040036 | orthology | 1 | 6 | - | - |
| soybn_pan_p040183 | orthology | 0.821 | 6 | 135 | 1.71e-41 |
| soybn_pan_p040952 | orthology | 0.798 | 6 | - | - |
| soybn_pan_p042566 | orthology | 0.88 | 6 | - | - |
| vitvi_pan_p014384 | orthology | 0.471 | 2 | - | - |