Gene thecc_pan_p006409
Sequence ID | thecc_pan_p006409 add to my list | ||
---|---|---|---|
Species | Theobroma cacao | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 86aa | ||
Gene Ontology |
![]()
|
Length: 86 amino acids
>thecc_pan_p006409_THECC MSQTVFLKVGMSCEGCVGAVKRVLGKMEGVESYEVDLKEQKVTVKGNVQPDAVLQTVSKT GKKTTFWETEAPAEPEAKPAEAVATA
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for thecc_pan_p006409
Represented sequence(s):
THECC_Matina1_6_v1.1
THECC_Criollo_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
cajca.ICPL87119.gnm1.ann1.C.cajan_24641.1 | orthology | 0.328 | 3 | 114 | 2.92e-35 |
cicar_pan_p009659 | orthology | 0.403 | 2 | 111 | 3.46e-34 |
medtr_pan_p015003 | orthology | 0.404 | 2 | 125 | 1.09e-39 |
phavu.G19833.gnm2.ann1.Phvul.007G103800.1 | orthology | 0.316 | 3 | 125 | 9.87e-40 |
soybn_pan_p011435 | orthology | 0.298 | 2 | 130 | 2.88e-41 |
soybn_pan_p033763 | orthology | 0.299 | 2 | - | - |
vitvi_pan_p027163 | orthology | 0.227 | 2 | 143 | 1.67e-46 |
vitvi_pan_p043448 | orthology | 0.243 | 2 | - | - |
vitvi_pan_p043537 | orthology | 0.227 | 2 | - | - |