Gene thecc_pan_p011528
| Sequence ID | thecc_pan_p011528 add to my list | ||
|---|---|---|---|
| Species | Theobroma cacao | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 149aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 149 amino acids
>thecc_pan_p011528_THECC MGVEGTLEYISDLLSSVKKKKKKHTQTVALKIRMDCEGCARKVKKVLSGVKGAKSVDVDL KQQKATVTGYVEAKKVLAAAQSTKKKVELWPYVPYTLVANPYVAQAYDKKAPLNHVRAVP LTANITETTMDDGYTNMFSDENPNACSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for thecc_pan_p011528
Represented sequence(s):
THECC_Matina1_6_v1.1
THECC_Criollo_v2.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT4G08570.1 | orthology | 0.329 | 4 | 214 | 8.78e-73 |
| Cg3g015470.1 | orthology | 0.205 | 3 | 238 | 3.12e-82 |
| Cm020980.1 | orthology | 0.195 | 2 | 239 | 2.6e-82 |
| Cs3g18690.1 | orthology | 0.205 | 3 | 238 | 3.4e-82 |
| Manes.18G070700.1 | orthology | 0.163 | 2 | 251 | 1.73e-87 |
| brana_pan_p007268 | orthology | 0.403 | 5 | - | - |
| braol_pan_p017356 | orthology | 0.403 | 5 | - | - |
| brarr_pan_p027720 | orthology | 0.355 | 4 | 189 | 3.55e-63 |