Gene thecc_pan_p012699
| Sequence ID | thecc_pan_p012699 add to my list | ||
|---|---|---|---|
| Species | Theobroma cacao | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 283aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 283 amino acids
>thecc_pan_p012699_THECC MEHRQALPTCTLKVNINCCTMCRLKVKEKLQKIKGVESIVYDSDGVVTVSGKVNPMTIVK KLEKWGKYAELLSFRRSPKQDVQGSTSCSNKGVDNSDHHGSHSKMEKDCCCRCDAVSDSD DDHDHGQDDNGEVPAAKKSNASITCQHPDPTISKQSRKGKVKKRFIGLFSKNIGGAKKNL DETKSRVSTIGKPSTMDRPSKWRFPWTPMPKYGGPMPYNRPFESYPPPVTGRPAAPPYHP FGLMRPPPSPAVPPPYGFFNSRPPPKVNPMIHYTSYADNYSYW
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for thecc_pan_p012699
Represented sequence(s):
THECC_Criollo_v2.0
THECC_Matina1_6_v1.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT1G30473.1 | orthology | 1 | 3 | - | - |
| AT4G23882.1 | orthology | 1 | 2 | 72.8 | 6.74e-15 |
| Cg7g023400.1 | orthology | 1 | 4 | 102 | 4.38e-26 |
| Cm012520.1 | orthology | 1 | 4 | 119 | 1.05e-31 |
| Cs7g01670.1 | orthology | 1 | 3 | 122 | 4.63e-33 |
| MELO3C015862.2.1 | orthology | 1 | 4 | - | - |
| brana_pan_p050558 | orthology | 1 | 4 | 61.6 | 1.63e-11 |
| braol_pan_p028920 | orthology | 1 | 4 | 61.6 | 8.34e-11 |
| cucsa_pan_p009937 | orthology | 1 | 4 | - | - |
| maldo_pan_p011650 | orthology | 1 | 3 | 88.6 | 1.3e-20 |