Gene thecc_pan_p013140
| Sequence ID | thecc_pan_p013140 add to my list | ||
|---|---|---|---|
| Species | Theobroma cacao | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 310aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 310 amino acids
>thecc_pan_p013140_THECC MGEKKNGNKKGGDGEKKEKVSVVLKVDCLCDGCAEKITKHIRGFEGVETVQADSSSNKVT VVGAVDPAAIKEKLEKKTKKKVDLISPQPKKDDNKEEKKEKKADKEKNPDSNNKQEKKPK EAPVTTADLKVQMKCQCQGCRDKVNKIVSETKGVQESKIDKQKGLVTVKGTMDVKALAEA LKGKLKKNVEIVPPKKEKDGNKEGGEKGDGGGKNKTNNNKGGNGGGDGNGGPKMEGSRME SIVQPESGYMPGYPGYMAGYPGYGYGYGHPHPYPLQHGHGYPGYVPGYPVSVHPPHQMFN DENPNACTIL
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for thecc_pan_p013140
Represented sequence(s):
THECC_Criollo_v2.0
THECC_Matina1_6_v1.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G28090.1 | orthology | 0.996 | 3 | - | - |
| Cg8g019570.1 | orthology | 0.706 | 5 | 179 | 4.91e-54 |
| Cm049010.1 | orthology | 0.703 | 6 | - | - |
| Cm049020.1 | orthology | 0.733 | 5 | - | - |
| Cs8g15890.1 | orthology | 0.707 | 6 | - | - |
| Cs8g15900.1 | orthology | 0.761 | 5 | - | - |
| DCAR_015174 | orthology | 1 | 2 | - | - |
| Manes.04G015400.1 | orthology | 0.853 | 4 | - | - |
| Manes.11G150800.1 | orthology | 0.864 | 4 | - | - |
| Manes.11G150900.1 | orthology | 0.891 | 4 | 168 | 1.53e-49 |
| brana_pan_p035445 | orthology | 1 | 4 | - | - |
| brana_pan_p036106 | orthology | 1 | 4 | - | - |
| braol_pan_p002645 | orthology | 1 | 4 | - | - |
| braol_pan_p042787 | orthology | 1 | 4 | - | - |
| brarr_pan_p026563 | orthology | 1 | 4 | - | - |
| vitvi_pan_p000499 | orthology | 0.844 | 3 | 162 | 1.17e-47 |