Gene tritu_pan_p004483
Sequence ID | tritu_pan_p004483 add to my list | ||
---|---|---|---|
Species | Triticum turgidum | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 152aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 152 amino acids
>tritu_pan_p004483_TRITU MGALDHLSRLCNLTHTREAIRIKKRRPLTTVNIKVKMDCEGCERRVKSAVKSIRGVTAVV VNRKISKVTVTGYVEPRKVLARVKRTGKTTADMWPYVPYTVATYPYVGGSYDKKAPAGLV RNVPQAMADPAAPEVKYMNMFNDEDVTACTVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p004483
Represented sequence(s):
TRITU_Svevo_v2.0
TRITU_Zavitan_v1.1
1. | 2. | 3. | 4. | |
---|---|---|---|---|
1. TRIDC5Av2G156040.1 | 0.00 | 0.66 | 4.03 | 1.32 |
2. TraesCS5A02G244000.1 | 0.66 | 0.00 | 3.35 | 0.66 |
3. TraesCS5B02G242000.1 | 4.03 | 3.35 | 0.00 | 2.67 |
4. TraesCS5D02G250700.1 | 1.32 | 0.66 | 2.67 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU5Hr1G069380.4 | orthology | 0.157 | 1 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_29968.1 | orthology | 1 | 4 | - | - |
cicar_pan_p023670 | orthology | 0.888 | 2 | - | - |
medtr_pan_p021226 | orthology | 0.94 | 2 | - | - |
phavu.G19833.gnm2.ann1.Phvul.003G022400.1 | orthology | 1 | 3 | - | - |
soybn_pan_p016584 | orthology | 1 | 4 | - | - |