Gene tritu_pan_p011159
| Sequence ID | tritu_pan_p011159 add to my list | ||
|---|---|---|---|
| Species | Triticum turgidum | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 170aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 170 amino acids
>tritu_pan_p011159_TRITU MTIVEMQMNIDCDGCEDNVRKALLRLQGVHYVDVDRARDKVTVTGTATQKKVLRAARRTG KLVVLWPSAYDPGYHHAYAHAQPAYYSYQAKPASAAHAHRYYNSVPHGRSGYMPAAQYGS ASSYNYHVHGYYDSDLHGYYHEQQALSNAAVPADERSYFSDDNPSACSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP490354 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p011159
Represented sequence(s):
TRITU_Svevo_v2.0
TRITU_Zavitan_v1.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT1G29100.2 | orthology | 1 | 2 | - | - |
| brana_pan_p026075 | orthology | 1 | 4 | - | - |
| braol_pan_p020359 | orthology | 1 | 4 | - | - |
| brarr_pan_p033912 | orthology | 1 | 3 | - | - |