Gene tritu_pan_p016230
| Sequence ID | tritu_pan_p016230 add to my list | ||
|---|---|---|---|
| Species | Triticum turgidum | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 209aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 209 amino acids
>tritu_pan_p016230_TRITU MAPLLFKDMRSLSCSSPASTAICPSLERQPIFRPQKAGASPLFQVPAEPRAHRQDGRKGQ QQHHHHRAGVANGELASPAGSTRFLLSGCAAVDEIQEVATVAAAPPAAAPGGDVRREEPA AADVKNTNTSTQEQVVVLKVSLHCKACAGKVKKHLAKMEGVRTFSIDFAAKKVTVVGDVT PLGVLASVSKVKNAQIWAAAPPPQPAMAA
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p016230
Represented sequence(s):
TRITU_Zavitan_v1.1
TRITU_Svevo_v2.0
| 1. | 2. | 3. | 4. | |
|---|---|---|---|---|
| 1. TRIDC5Bv2G204900.1 | 0.00 | 3.91 | 2.42 | 3.91 |
| 2. TRIDC5Av2G228380.1 | 3.91 | 0.00 | 3.41 | -0.00 |
| 3. TraesCS5B02G488200.1 | 2.42 | 3.41 | 0.00 | 3.41 |
| 4. TraesCS5A02G475200.1 | 3.91 | -0.00 | 3.41 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HORVU5Hr1G112560.2 | orthology | 0.06 | 1 | 290 | 1.07e-100 |
| HORVU6Hr1G018250.1 | orthology | 0.354 | 1 | - | - |