Gene tritu_pan_p017403


Sequence ID tritu_pan_p017403  add to my list
Species Triticum turgidum
Alias No gene alias
Pangenome status Core (2/2)
Length 122aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 122 amino acids

>tritu_pan_p017403_TRITU
MGDLQIVLAGGTIEAQHVEMKVPLYSYGCEKKIKKALSNLKGIHSVQVDYHQQKVTVWGI
CNRNDVLAAVRRKRRAARFWGADQPDLGEDARQGDASKHYLRAFAAYRSRKSWKKLFPMI
RL


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP467872 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for tritu_pan_p017403



Represented sequence(s):
TRITU_Svevo_v2.0
TRIDC2Av2G223310.1
TRITU_Zavitan_v1.1
TraesCS2A02G394500.1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU2Hr1G093870.1 orthology 0.0268 1 - -
Mba04_g24060.1 orthology 0.745 6 - -
XP_008808278.1 orthology 0.832 6 147 7.02e-47
XP_010919018.1 orthology 0.839 7 - -
XP_010934032.1 orthology 0.797 6 - -
bradi_pan_p042306 orthology 0.141 2 - -
cocnu_pan_p020678 orthology 0.813 6 - -
cocnu_pan_p024529 orthology 0.886 7 - -
musac_pan_p009117 orthology 0.76 6 - -
orysa_pan_p048607 orthology 0.197 3 - -
orysa_pan_p051674 orthology 0.661 3 - -
tritu_pan_p012747 ultra-paralogy 0.0256 0 - -
tritu_pan_p047012 ultra-paralogy 0.0182 0 - -