Gene tritu_pan_p017661
Sequence ID | tritu_pan_p017661 add to my list |
---|---|
Species | Triticum turgidum |
Alias | No gene alias |
Pangenome status | Dispensable (1/2) |
Length | 77aa |
Length: 77 amino acids
>tritu_pan_p017661_TRITU MATKCIIGALVGSLGIAYVCDTIVSDKKIFGGTVCKTATDKEWFQATDAKFQAWPRTAGP PVIMNPISRQNFIVKHP
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for tritu_pan_p017661
Represented sequence(s):
Unrepresented genome(s):
TRITU_Zavitan_v1.1
TRITU_Svevo_v2.0
1. | 2. | 3. | |
---|---|---|---|
1. TraesCS2A02G584200.1 | 0.00 | 6.73 | 3.98 |
2. TraesCS2B02G602500.1 | 6.73 | 0.00 | 5.34 |
3. TraesCS2D02G595800.1 | 3.98 | 5.34 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr18262 | orthology | 0.642 | 1 | 130 | 1.06e-40 |