Gene tritu_pan_p021816
| Sequence ID | tritu_pan_p021816 add to my list |
|---|---|
| Species | Triticum turgidum |
| Alias | No gene alias |
| Pangenome status | Dispensable (1/2) |
| Length | 79aa |
Length: 79 amino acids
>tritu_pan_p021816_TRITU MAGKYIVAGLVGSCVISYACDYIVSQKKIFGGTIPGTVSDKEWLKATEQRFQAWPRVAGP PVIMNPISRQNFIVKDLNP
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for tritu_pan_p021816
Represented sequence(s):
Unrepresented genome(s):
TRITU_Zavitan_v1.1
TRITU_Svevo_v2.0
| 1. | 2. | |
|---|---|---|
| 1. TraesCS4A02G445300.1 | 0.00 | -0.00 |
| 2. TraesCS7A02G041600.1 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HORVU7Hr1G007610.1 | orthology | 0.0636 | 1 | 157 | 5.89e-52 |