Gene tritu_pan_p031058
| Sequence ID | tritu_pan_p031058 add to my list | ||
|---|---|---|---|
| Species | Triticum turgidum | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 162aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 162 amino acids
>tritu_pan_p031058_TRITU MGVGGTLEYLSGLLGGGGGHGHGHGHGNRRRRKQMQTVELKVSMDCEGCERKVKNALSSM KGVRSVNINRKQQKVTVAGYADASKVLRKAQSTGKKAEIWPYVPYSQVSQPYVAGTYDKR APAGYVRSQEPGYGNVSGQVSRQDDQLTDMFNDDNANSCAVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p031058
Represented sequence(s):
TRITU_Zavitan_v1.1
TRITU_Svevo_v2.0
| 1. | 2. | 3. | 4. | 5. | |
|---|---|---|---|---|---|
| 1. TRIDC2Av2G052210.1 | 0.00 | 1.24 | -0.00 | 1.24 | 2.50 |
| 2. TRIDC2Bv2G057630.1 | 1.24 | 0.00 | 1.24 | -0.00 | 1.24 |
| 3. TraesCS2A02G160700.1 | -0.00 | 1.24 | 0.00 | 1.24 | 2.50 |
| 4. TraesCS2B02G186900.1 | 1.24 | -0.00 | 1.24 | 0.00 | 1.24 |
| 5. TraesCS2D02G168000.1 | 2.50 | 1.24 | 2.50 | 1.24 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba07_g10470.1 | orthology | 0.629 | 3 | - | - |
| XP_008798426.1 | orthology | 0.468 | 3 | - | - |
| XP_010916917.1 | orthology | 0.454 | 3 | - | - |
| XP_010926254.1 | orthology | 0.532 | 4 | - | - |
| bradi_pan_p025295 | orthology | 0.2 | 1 | 233 | 1.24e-79 |
| cocnu_pan_p024481 | orthology | 0.555 | 4 | - | - |
| cocnu_pan_p026004 | orthology | 0.452 | 3 | - | - |
| cocnu_pan_p035557 | orthology | 0.554 | 3 | - | - |
| musac_pan_p025676 | orthology | 0.644 | 3 | - | - |