Gene tritu_pan_p039370
Sequence ID | tritu_pan_p039370 add to my list | ||
---|---|---|---|
Species | Triticum turgidum | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 186aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 186 amino acids
>tritu_pan_p039370_TRITU MRTGGMLCRSQAATAVCVPGDARSMVVGRRSDRTIAEDARTLHDVRYVRLGGDGAGAARV SSRRVAPPQPPPMPRRRGAPVAVTLPMVTKSPVETPARDTAAAKRTSATPTAAVAPGDQV LQVVVMKVAIHCQGCAGKVRKHISKMEGVTSFSIDLESKKVTVMGHVSPAGVLESVSKVK KAELLM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p039370
Represented sequence(s):
TRITU_Zavitan_v1.1
TRITU_Svevo_v2.0
1. | 2. | 3. | 4. | 5. | |
---|---|---|---|---|---|
1. TRIDC1Av2G157570.2 | 0.00 | 4.40 | 0.54 | 4.40 | 4.97 |
2. TRIDC1Bv2G144640.2 | 4.40 | 0.00 | 3.84 | -0.00 | 1.63 |
3. TraesCS1A02G283600.1 | 0.54 | 3.84 | 0.00 | 3.84 | 4.40 |
4. TraesCS1B02G292800.1 | 4.40 | -0.00 | 3.84 | 0.00 | 1.63 |
5. TraesCS1D02G282700.1 | 4.97 | 1.63 | 4.40 | 1.63 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr07514 | orthology | 0.626 | 4 | 150 | 1.22e-46 |
HORVU1Hr1G072500.1 | orthology | 0.05 | 1 | 310 | 2.17e-109 |
ORGLA08G0123900.1 | orthology | 0.178 | 4 | 262 | 2.39e-90 |
XP_008809313.1 | orthology | 0.661 | 7 | 176 | 9.43e-57 |
XP_010905917.1 | orthology | 0.66 | 8 | 179 | 6.12e-58 |
bradi_pan_p028136 | orthology | 0.132 | 2 | 296 | 1.33e-103 |
cocnu_pan_p015352 | orthology | 0.654 | 8 | 173 | 9.71e-56 |
musac_pan_p004339 | orthology | 0.714 | 5 | - | - |
orysa_pan_p015149 | orthology | 0.181 | 4 | 258 | 1.22e-88 |
orysa_pan_p029167 | orthology | 0.43 | 4 | - | - |