Gene tritu_pan_p042574


Sequence ID tritu_pan_p042574  add to my list
Species Triticum turgidum
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 100aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 100 amino acids

>tritu_pan_p042574_TRITU
MDCEGCERRVKNAVKSIRGVTSVAVNPKMSKVTVTGHVEPRKVLERVKSTGKAAEMWPYV
PYTLATYPTSAAPTTRRHRRASSAAHRRPWPTPRRLRSTT




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for tritu_pan_p042574



Represented sequence(s):
TRITU_Zavitan_v1.1
TraesCS3B02G238100.1
Unrepresented genome(s):
TRITU_Svevo_v2.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
cajca.ICPL87119.gnm1.ann1.C.cajan_29968.1 orthology 1 3 - -
cicar_pan_p023670 orthology 1 1 - -
medtr_pan_p021226 orthology 1 1 - -
phavu.G19833.gnm2.ann1.Phvul.003G022400.1 orthology 1 2 - -
soybn_pan_p016584 orthology 1 3 - -