Gene tritu_pan_p042574
Sequence ID | tritu_pan_p042574 add to my list | ||
---|---|---|---|
Species | Triticum turgidum | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 100aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 100 amino acids
>tritu_pan_p042574_TRITU MDCEGCERRVKNAVKSIRGVTSVAVNPKMSKVTVTGHVEPRKVLERVKSTGKAAEMWPYV PYTLATYPTSAAPTTRRHRRASSAAHRRPWPTPRRLRSTT
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p042574
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
cajca.ICPL87119.gnm1.ann1.C.cajan_29968.1 | orthology | 1 | 3 | - | - |
cicar_pan_p023670 | orthology | 1 | 1 | - | - |
medtr_pan_p021226 | orthology | 1 | 1 | - | - |
phavu.G19833.gnm2.ann1.Phvul.003G022400.1 | orthology | 1 | 2 | - | - |
soybn_pan_p016584 | orthology | 1 | 3 | - | - |