Gene tritu_pan_p047012
Sequence ID | tritu_pan_p047012 add to my list | ||
---|---|---|---|
Species | Triticum turgidum | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 123aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 123 amino acids
>tritu_pan_p047012_TRITU MGDLQIVLAGGTIEAQHVEMKVPLYSYGCEKKIKKALSNLKGIHSVQVDYHQQKVTVWGI CNRNDVLAAVRRKRRAARFWGADQPDLGEDARLLGDAPKHYLRAFAAYRSRKSWKKLFPM IRL
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP342521 | Unannotated cluster |
4 | GP467872 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p047012
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU2Hr1G093870.1 | orthology | 0.0096 | 1 | - | - |
Mba04_g24060.1 | orthology | 0.728 | 6 | - | - |
XP_008808278.1 | orthology | 0.814 | 6 | - | - |
XP_010919018.1 | orthology | 0.822 | 7 | - | - |
XP_010934032.1 | orthology | 0.78 | 6 | - | - |
bradi_pan_p042306 | orthology | 0.124 | 2 | 229 | 2.79e-79 |
cocnu_pan_p020678 | orthology | 0.796 | 6 | - | - |
cocnu_pan_p024529 | orthology | 0.869 | 7 | - | - |
musac_pan_p009117 | orthology | 0.743 | 6 | - | - |
orysa_pan_p048607 | orthology | 0.18 | 3 | - | - |
orysa_pan_p051674 | orthology | 0.644 | 3 | - | - |
tritu_pan_p012747 | ultra-paralogy | 0.0095 | 0 | - | - |
tritu_pan_p017403 | ultra-paralogy | 0.0182 | 0 | - | - |