Gene tritu_pan_p047212
Sequence ID | tritu_pan_p047212 add to my list | ||
---|---|---|---|
Species | Triticum turgidum | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 77aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 77 amino acids
>tritu_pan_p047212_TRITU MQTVELRVGMSCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVTPDAVLQTVSKTG KKTSFWEAEPSASAVSS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p047212
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
ORGLA08G0053300.1 | orthology | 0.301 | 4 | - | - |
bradi_pan_p028026 | orthology | 0.375 | 2 | - | - |
orysa_pan_p019494 | orthology | 0.301 | 4 | - | - |
tritu_pan_p023672 | orthology | 0 | 1 | - | - |