Gene tritu_pan_p047212


Sequence ID tritu_pan_p047212  add to my list
Species Triticum turgidum
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 77aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 77 amino acids

>tritu_pan_p047212_TRITU
MQTVELRVGMSCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVTPDAVLQTVSKTG
KKTSFWEAEPSASAVSS




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for tritu_pan_p047212



Represented sequence(s):
TRITU_Zavitan_v1.1
TraesCS7D02G342900.1
Unrepresented genome(s):
TRITU_Svevo_v2.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
ORGLA08G0053300.1 orthology 0.301 4 - -
bradi_pan_p028026 orthology 0.375 2 - -
orysa_pan_p019494 orthology 0.301 4 - -
tritu_pan_p023672 orthology 0 1 - -