Gene tritu_pan_p048029
Sequence ID | tritu_pan_p048029 add to my list | ||
---|---|---|---|
Species | Triticum turgidum | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 161aa | ||
Gene Ontology |
![]()
|
Length: 161 amino acids
>tritu_pan_p048029_TRITU MGGGIKQLLASLLGAVGGGQRGAKKESTRPQPQTVELRVRMDCERCERQVKKALAGMRGV ERVEVNRKQQRVTVTGVVDPHKVLRRAQSTGKKAELWPRNHHHPGYDDNSAAVTAHYGAI GAAQAHGRWAPSPYRRNADAASAEQIASLFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for tritu_pan_p048029
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HanXRQChr11g0339531 | orthology | 1 | 3 | - | - |
Sspon.04G0003210-2C | orthology | 0.634 | 3 | - | - |
bradi_pan_p043115 | orthology | 0.519 | 2 | 146 | 9.05e-46 |
maize_pan_p029187 | orthology | 0.681 | 4 | 139 | 2.33e-42 |
orysa_pan_p045119 | orthology | 0.53 | 2 | 169 | 1.6e-54 |
sorbi_pan_p004683 | orthology | 0.606 | 4 | 134 | 1.02e-40 |
tritu_pan_p006814 | ultra-paralogy | 0.0746 | 0 | - | - |