Gene tritu_pan_p048949


Sequence ID tritu_pan_p048949  add to my list
Species Triticum turgidum
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 109aa



Length: 109 amino acids

>tritu_pan_p048949_TRITU
MATTFTLLGAASSHGPGAGLAAGDDGHHNCNGCYHCQKIRRALLQMQELESHLIDRKNGR
VSVWGAFSPQDVAIKIRKRTNRRVEILELWEAAGPGGGDEQGVGGGQMP




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain

IPR006121
Figure 1: IPR domains for tritu_pan_p048949



Represented sequence(s):
TRITU_Svevo_v2.0
TRIDC4Av2G115280.1
Unrepresented genome(s):
TRITU_Zavitan_v1.1


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
ORGLA09G0073900.1 orthology 0.492 3 - -
bradi_pan_p028263 orthology 0.429 2 - -
maize_pan_p009159 orthology 0.502 3 - -
musac_pan_p023320 orthology 0.823 3 - -
orysa_pan_p037625 orthology 0.6 3 - -
sorbi_pan_p029803 orthology 0.4 3 - -
tritu_pan_p004118 ultra-paralogy 0.118 0 - -
tritu_pan_p024914 ultra-paralogy 0.107 0 - -
tritu_pan_p040052 ultra-paralogy 0.0953 0 - -