Gene vitvi_pan_p003255
| Sequence ID | vitvi_pan_p003255 add to my list | ||
|---|---|---|---|
| Species | Vitis vinifera | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 148aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 148 amino acids
>vitvi_pan_p003255_VITVI MFGWRSGTHRLSNAMSIVELLVHMDCEGCEKRIRRAISKLSGVDHLDIDMDKQKVTVTGY VDQRQVLKVVRRTGRKAEFWPYPYDSEYYPYAAQYLDESTYTSSYNYYMHGYNESVHGYF PDPPYPILIDDQTAHIFSDDNVHACSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for vitvi_pan_p003255
Represented sequence(s):
VITVI_12X.2
VITVI_Carmenere_v1.0
VITVI_CabernetSauvignon_v1.0
| 1. | 2. | 3. | 4. | 5. | 6. | 7. | |
|---|---|---|---|---|---|---|---|
| 1. Vitvi08g00886.t01 | 0.00 | -0.00 | -0.00 | -0.00 | -0.00 | -0.00 | -0.00 |
| 2. VvCabSauv08_H0001F_084.ver1.0.g023900.m01 | -0.00 | 0.00 | -0.00 | -0.00 | -0.00 | -0.00 | -0.00 |
| 3. VvCabSauv08_P0001F.ver1.0.g273900.m01 | -0.00 | -0.00 | 0.00 | -0.00 | -0.00 | -0.00 | -0.00 |
| 4. VvCarFPS02VCR702_v1_Hc0166F_006.ver1_0.g627030.m01 | -0.00 | -0.00 | -0.00 | 0.00 | -0.00 | -0.00 | -0.00 |
| 5. VvCarFPS02VCR702_v1_Hc0166F_009.ver1_0.g627110.m01 | -0.00 | -0.00 | -0.00 | -0.00 | 0.00 | -0.00 | -0.00 |
| 6. VvCarFPS02VCR702_v1_Hc0166F_012.ver1_0.g627290.m01 | -0.00 | -0.00 | -0.00 | -0.00 | -0.00 | 0.00 | -0.00 |
| 7. VvCarFPS02VCR702_v1_PsGc_855.ver1_0.g372730.m01 | -0.00 | -0.00 | -0.00 | -0.00 | -0.00 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G56891.1 | orthology | 0.698 | 4 | 136 | 6.98e-42 |
| Ca_28_123.1 | orthology | 0.417 | 3 | - | - |
| Ca_31_155.3 | orthology | 0.373 | 3 | - | - |
| Ca_64_676.1 | orthology | 0.334 | 3 | - | - |
| Ca_78_1273.1 | orthology | 0.373 | 3 | - | - |
| Cc06_g21060 | orthology | 0.288 | 3 | 137 | 1.02e-42 |
| Cg6g011520.1 | orthology | 0.305 | 7 | 179 | 3.93e-59 |
| Cs6g10930.1 | orthology | 0.299 | 7 | 174 | 1.05e-56 |
| DCAR_016949 | orthology | 0.434 | 3 | - | - |
| FvH4_2g26780.1 | orthology | 0.306 | 5 | 187 | 1.21e-61 |
| MELO3C019416.2.1 | orthology | 0.384 | 7 | 160 | 1.95e-51 |
| Manes.08G099200.1 | orthology | 0.253 | 3 | 179 | 9.47e-59 |
| Oeu053981.1 | orthology | 0.354 | 4 | - | - |
| brana_pan_p032952 | orthology | 0.846 | 5 | - | - |
| brana_pan_p033418 | orthology | 0.817 | 6 | - | - |
| brana_pan_p049288 | orthology | 0.845 | 4 | 142 | 8.4e-44 |
| braol_pan_p001934 | orthology | 0.851 | 5 | - | - |
| braol_pan_p038031 | orthology | 0.793 | 5 | 142 | 3.68e-44 |
| brarr_pan_p006813 | orthology | 0.817 | 6 | 139 | 5.34e-43 |
| brarr_pan_p018750 | orthology | 0.85 | 4 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 | orthology | 0.442 | 9 | 147 | 1.65e-46 |
| cucsa_pan_p011351 | orthology | 0.417 | 7 | 148 | 9.64e-47 |
| ipotf_pan_p003030 | orthology | 0.514 | 5 | 147 | 3.67e-46 |
| itb11g01700.t1 | orthology | 0.51 | 5 | 147 | 1.97e-46 |
| maldo_pan_p024328 | orthology | 0.39 | 5 | - | - |
| maldo_pan_p038662 | orthology | 0.297 | 5 | 175 | 4.59e-57 |
| medtr_pan_p030129 | orthology | 0.393 | 7 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.004G052700.1 | orthology | 0.44 | 8 | 155 | 1.49e-49 |
| soybn_pan_p020075 | orthology | 0.458 | 9 | - | - |
| thecc_pan_p019791 | orthology | 0.258 | 6 | 180 | 1.94e-59 |