Gene vitvi_pan_p019515


Sequence ID vitvi_pan_p019515  add to my list
Species Vitis vinifera
Alias No gene alias
Pangenome status Core (3/3)
Length 345aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 345 amino acids

>vitvi_pan_p019515_VITVI
MGEAKDAGEKKADAGEKKADAGEKKAEGPAPAVFKIDLHCDGCAKKVRRYVRNFDGVEDV
KVDSASNKVTVTGKADPVKLREKLEEKTKKEVALISPVPKKEAKDGGADKKTDDKSEKKS
DEKKSDEKKADDKKPKETPVSTVVLKIRLHCDGCIHKIKKIISKSKGVKTVTVDSQKDLV
TVTGPMDVKELIPYLKEKLRRTVEIVSPKKDDAGGDKKEKGGGGDKKEGGGEKKKEGDGK
AAGGEKKEGEAKAASGGKQEEGGVKVEVNKMEYHGYGYAPPPQYYYGPPMYNHGYPAEGP
SQWYEPPMYGQGYSGEGPSHHGYVVEHTPPPQIFSDENPNACSVM


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP071484 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for vitvi_pan_p019515



Download sequences FASTA

  1. 2. 3. 4. 5. 6.
1. Vitvi08g00992.t01 0.00 1.76 7.38 -0.00 1.76 1.76
2. VvCabSauv08_P0001F.ver1.0.g272730.m01 1.76 0.00 9.09 2.27 -0.00 -0.00
3. VvCabSauv08_H0001F_084.ver1.0.g022750.m01 7.38 9.09 0.00 9.52 9.09 9.09
4. VvCabSauv08_H0001F_072.ver1.0.g021410.m01 -0.00 2.27 9.52 0.00 2.27 2.27
5. VvCarFPS02VCR702_v1_Hc0062F_002.ver1_0.g540320.m01 1.76 -0.00 9.09 2.27 0.00 -0.00
6. VvCarFPS02VCR702_v1_PsGc_706.ver1_0.g313340.m01 1.76 -0.00 9.09 2.27 -0.00 0.00