Gene vitvi_pan_p020409


Sequence ID vitvi_pan_p020409  add to my list
Species Vitis vinifera
Alias No gene alias
Pangenome status Core (3/3)
Length 217aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 217 amino acids

>vitvi_pan_p020409_VITVI
MHCEGCANKVLKSLRGFDGVEEVETDRKNHKVIVKGEKADPLKVLERVKKKCGKNVELLS
PIPKAKEPQENKKEAKEEPRVMIVVLKVYMHCENCAVEIKKAILKMKGVRTVEPDTKNST
VTVKGVFDPPKLIDHLHNRAGKHAVILKQNEEKKQKKQEVKEMRETDKKSDIKEGIEEQW
GNEIDSDFFYYNSQYPYQHLYPYQFFSEENTNACSIL


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP070448 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for vitvi_pan_p020409



Download sequences FASTA

  1. 2. 3. 4. 5.
1. Vitvi01g01695.t01 0.00 11.93 -0.00 2.61 -0.00
2. VvCabSauv08_P0020F.ver1.0.g356790.m01 11.93 0.00 10.12 14.74 11.93
3. VvCabSauv08_H0020F_029.ver1.0.g103940.m01 -0.00 10.12 0.00 3.09 -0.00
4. VvCarFPS02VCR702_v1_PsGc_37.ver1_0.g181070.m01 2.61 14.74 3.09 0.00 2.61
5. VvCarFPS02VCR702_v1_Hc0191F_004.ver1_0.g637940.m01 -0.00 11.93 -0.00 2.61 0.00


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
vitvi_pan_p037360 ultra-paralogy 0.0231 0 - -