Gene vitvi_pan_p026446
| Sequence ID | vitvi_pan_p026446 add to my list | ||
|---|---|---|---|
| Species | Vitis vinifera | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 146aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 146 amino acids
>vitvi_pan_p026446_VITVI MTTIEMRVHMDCAGCESKIKKTLQKLKGVDSIEIDMATQKVTVTGWADQKKVLKAVRKTG RRAELWSLPYNPEHHNGTDYFNISQHHCNGPLTHFTPQPSSYYNYYKHGYDSHDGSYYHR PPQSTIFGEQTGAAFSDDNPNACSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for vitvi_pan_p026446
Represented sequence(s):
VITVI_Carmenere_v1.0
VITVI_CabernetSauvignon_v1.0
VITVI_12X.2
| 1. | 2. | 3. | 4. | 5. | 6. | |
|---|---|---|---|---|---|---|
| 1. Vitvi12g00186.t01 | 0.00 | 0.69 | 1.38 | 1.38 | 1.43 | 1.43 |
| 2. VvCabSauv08_H0107F_010.ver1.0.g208490.m01 | 0.69 | 0.00 | 0.69 | 0.69 | 0.71 | 0.71 |
| 3. VvCabSauv08_P0107F.ver1.0.g497630.m01 | 1.38 | 0.69 | 0.00 | -0.00 | -0.00 | -0.00 |
| 4. VvCarFPS02VCR702_v1_Hc0088F_011.ver1_0.g571960.m01 | 1.38 | 0.69 | -0.00 | 0.00 | -0.00 | -0.00 |
| 5. VvCarFPS02VCR702_v1_Hc0088F_010.ver1_0.g571870.m01 | 1.43 | 0.71 | -0.00 | -0.00 | 0.00 | -0.00 |
| 6. VvCarFPS02VCR702_v1_PsGc_646.ver1_0.g286060.m01 | 1.43 | 0.71 | -0.00 | -0.00 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT1G06330.1 | orthology | 0.475 | 4 | 209 | 7.44e-71 |
| Cg2g008690.1 | orthology | 0.474 | 5 | 215 | 1.76e-73 |
| Cm103060.1 | orthology | 0.469 | 6 | 216 | 2.08e-73 |
| Cs2g15540.1 | orthology | 0.469 | 6 | 218 | 4.22e-74 |
| FvH4_6g27360.1 | orthology | 0.459 | 3 | 193 | 1.3e-64 |
| MELO3C018725.2.1 | orthology | 0.484 | 2 | 197 | 4.22e-66 |
| Manes.15G048400.1 | orthology | 0.363 | 4 | 230 | 3.13e-79 |
| brana_pan_p013116 | orthology | 0.452 | 5 | 201 | 3.97e-67 |
| braol_pan_p024201 | orthology | 0.452 | 5 | 201 | 3.6e-67 |
| brarr_pan_p028890 | orthology | 0.452 | 5 | 201 | 3.21e-67 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_23872.1 | orthology | 0.495 | 7 | 204 | 3.72e-69 |
| cucsa_pan_p019751 | orthology | 0.475 | 2 | 198 | 9.77e-67 |
| medtr_pan_p000903 | orthology | 0.529 | 5 | 204 | 6.95e-69 |
| phavu.G19833.gnm2.ann1.Phvul.005G095400.1 | orthology | 0.503 | 6 | 212 | 5.22e-72 |
| soybn_pan_p032804 | orthology | 0.496 | 7 | 210 | 3.02e-71 |
| thecc_pan_p014674 | orthology | 0.35 | 5 | 184 | 6.97e-61 |