Gene vitvi_pan_p026901
Sequence ID | vitvi_pan_p026901 add to my list | ||
---|---|---|---|
Species | Vitis vinifera | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 160aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 160 amino acids
>vitvi_pan_p026901_VITVI MGALDYFSNLCECRSLHESRQLHKLRKLKQLQTVEIKVKMDCEGCERQVRKSVEGMKGVT QVVIEPKLNKLTVVGYVEPKKVLHRVKHRTGKRPVMWPYVPYDEIPHPYAPGVYDRKAPP GYVRNPSQDPQVSNLARASSTEVKYTTAFSDDNPNACIIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for vitvi_pan_p026901
Represented sequence(s):
VITVI_Carmenere_v1.0
VITVI_CabernetSauvignon_v1.0
VITVI_12X.2
1. | 2. | 3. | 4. | 5. | |
---|---|---|---|---|---|
1. Vitvi04g02170.t01 | 0.00 | 1.26 | 0.63 | 1.26 | 1.26 |
2. Vitvi04g02172.t01 | 1.26 | 0.00 | 0.63 | 1.26 | 1.26 |
3. VvCabSauv08_H0004F_018.ver1.0.g043290.m01 | 0.63 | 0.63 | 0.00 | 0.63 | 0.63 |
4. VvCabSauv08_H0004F_058.ver1.0.g045770.m01 | 1.26 | 1.26 | 0.63 | 0.00 | -0.00 |
5. VvCarFPS02VCR702_v1_PsGc_228.ver1_0.g116130.m01 | 1.26 | 1.26 | 0.63 | -0.00 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62029504-RA | orthology | 0.493 | 1 | - | - |