Gene vitvi_pan_p037360
Sequence ID | vitvi_pan_p037360 add to my list |
---|---|
Species | Vitis vinifera |
Alias | No gene alias |
Pangenome status | Specific (1/3) |
Length | 112aa |
Length: 112 amino acids
>vitvi_pan_p037360_VITVI MKGVRTVEPDTKNSTVTVKGVFDPQKLVDHLHNRAGKHAVILKQDEEKKQKKQEVKEMRE TDKKSDIKEGIEEQWGNEIDSDFFYYNSQYPYQHLYPYQFFSEENTNACSIL
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Figure 1: IPR domains for vitvi_pan_p037360
Represented sequence(s):
Unrepresented genome(s):
VITVI_Carmenere_v1.0
VITVI_12X.2
VITVI_CabernetSauvignon_v1.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
vitvi_pan_p020409 | ultra-paralogy | 0.0231 | 0 | - | - |