Gene vitvi_pan_p040075
| Sequence ID | vitvi_pan_p040075 add to my list | ||
|---|---|---|---|
| Species | Vitis vinifera | ||
| Alias | No gene alias | ||
| Pangenome status | Specific (1/3) | ||
| Length | 161aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 161 amino acids
>vitvi_pan_p040075_VITVI MTKDEDFKLLKIQTCVLKVNIHCDGCKQKVKKLLQRIEGVYTVNIDAEQQRVTVSGSVDS GTLIKKLVKADDKNNKGQKQGLIKELEAFKTQQKFPVFSSEEDEDDFDDDEEDYEEEELR FLQEKANQLSLLRQQALDASNAKKGFGAIAAFQTMARSTIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for vitvi_pan_p040075
Represented sequence(s):
Unrepresented genome(s):
VITVI_Carmenere_v1.0
VITVI_12X.2
VITVI_CabernetSauvignon_v1.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg2g033940.2 | orthology | 0.303 | 4 | - | - |
| Cm053230.1 | orthology | 0.308 | 5 | - | - |
| FvH4_4g32260.1 | orthology | 0.432 | 3 | - | - |
| Manes.15G126600.1 | orthology | 0.378 | 4 | - | - |
| Manes.17G075400.1 | orthology | 0.365 | 4 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_07848.1 | orthology | 0.386 | 3 | - | - |
| cicar_pan_p014991 | orthology | 0.392 | 3 | - | - |
| maldo_pan_p009716 | orthology | 0.367 | 3 | - | - |
| maldo_pan_p033106 | orthology | 0.4 | 3 | - | - |
| medtr_pan_p032193 | orthology | 0.401 | 3 | - | - |
| orange1.1t04788.1 | orthology | 0.31 | 5 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.007G038000.1 | orthology | 0.396 | 4 | - | - |
| soybn_pan_p012384 | orthology | 0.365 | 4 | - | - |
| soybn_pan_p023139 | orthology | 0.358 | 4 | - | - |
| thecc_pan_p016247 | orthology | 0.352 | 4 | - | - |
| vitvi_pan_p018179 | ultra-paralogy | 0.0414 | 0 | - | - |