Gene vitvi_pan_p041887
Sequence ID | vitvi_pan_p041887 add to my list |
---|---|
Species | Vitis vinifera |
Alias | No gene alias |
Pangenome status | Specific (1/3) |
Length | 95aa |
Length: 95 amino acids
>vitvi_pan_p041887_VITVI MKGFQDLKLSYFKDSGQAPKAVKFSLPKDDGMSDDEFEVEWSDDRPTSDGCPSSVWQGFL FIYHLHLAPGVYIHAWPLLACNPDGHMPSSCFFIF
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
Unrepresented genome(s):
VITVI_Carmenere_v1.0
VITVI_12X.2
VITVI_CabernetSauvignon_v1.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
musac_pan_p039381 | orthology | 1 | 2 | - | - |
soybn_pan_p033623 | orthology | 1 | 1 | - | - |
soybn_pan_p040059 | orthology | 1 | 1 | - | - |